PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011197-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 301aa    MW: 34182.4 Da    PI: 10.0694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011197-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92e-073174445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     WT eE + + +a + + ++   +W ++a++++ g+t ++++  + 
    NNU_011197-RA 31 WTHEENKMFENALAVFDKDtpdRWYKVASMIP-GKTVEDVVKQYK 74
                     ********************************.*******99886 PP

2Myb_DNA-binding47.15.5e-15139183347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
    NNU_011197-RA 139 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 183
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.4042681IPR017884SANT domain
SMARTSM007171.6E-82779IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-112982IPR009057Homeodomain-like
PfamPF002491.0E-53175IPR001005SANT/Myb domain
CDDcd001676.57E-73177No hitNo description
PROSITE profilePS5129420.779132188IPR017930Myb domain
SuperFamilySSF466893.59E-17134188IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-18135187IPR006447Myb domain, plants
SMARTSM007174.5E-13136186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-12136182IPR009057Homeodomain-like
PfamPF002491.1E-12139183IPR001005SANT/Myb domain
CDDcd001672.94E-11139184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MMRFGMEVLS PANYHFTNSN WFVQESKSSG WTHEENKMFE NALAVFDKDT PDRWYKVASM  60
IPGKTVEDVV KQYKELVADV GHIEAGRIPI PGYRTSPFTL EWVNNRGFDG LKQSFVSGGR  120
RGGGASGRPS DQERKKGVPW TEEEHKLFLL GLKKYGKGDW RNISRNFVVT RTPTQVASHA  180
QKYFIRQQLS GGKDKRRSSI HDITTVNLTD IRSPSPDNNR VPSPDHSAVL PQQPKPKVQF  240
DWSQPNHGGH DIFFNQTNGN MFVSPPYGVT SYGQKMHGLN QQQEAFCGSQ IRPQHIAFQM  300
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1931961176RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123GGRRGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262772.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-123DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0MSI11e-146A0A0B0MSI1_G
TrEMBLA0A0D2TGI11e-146A0A0D2TGI1_G
STRINGVIT_06s0004g06100.t011e-145(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.13e-82Homeodomain-like transcriptional regulator